PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_465421436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 63aa    MW: 7435.42 Da    PI: 6.6355
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_465421436.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR129.23e-092563139
                   FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskeg 39
                           +fY++YA e GFsvrks+ +    ++ i+ r+ vCs++g
  Traes_3AS_465421436.1 25 EFYKKYALEKGFSVRKSYVEWDGSSKYIILRKIVCSRQG 63
                           6************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.8E-72563IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
ASDETMFEYL NVVNKMFDSE AEGYEFYKKY ALEKGFSVRK SYVEWDGSSK YIILRKIVCS  60
RQG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703066e-87HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231784.24e-21PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5CJY11e-39W5CJY1_WHEAT; Uncharacterized protein
STRINGBRADI2G37795.11e-20(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]